Recombinant Mouse SLAM Familielid 9/SLAMF9/CD2F-10 (C-6His)
Gecertificeerd

Recombinant Mouse SLAM Familielid 9/SLAMF9/CD2F-10 (C-6His)

Catalog #: 32-7644-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :24.7kD. Recombinant Mouse SLAMF9 is produced by our Mammalian expression system and the target gene encoding Phe18-Leu230 is expressed with a 6His tag at the C-terminus. Mouse SLAM family member 9 (Slamf9) is a single-pass type I membrane protein. The SLAMF9 gene encodes a member of the signaling lymphocytic activation molecule family. The encoded protein is a cell surface molecule that consists of two extracellular immunoglobulin domains, a transmembrane domain and a short cytoplasmic tail that lacks the signal transduction motifs found in other family members. The slamf9 protein may play a role in the immune response.

Gene Name

Slamf9

Gene ID

98365

UniProt

Q9D780

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

FSGDDEDPEEVIGVLQESINLSLEIPSNEEIKHIDWLFQNNIAIVKPGKKGQPAVITAVDPRYRGRVSISESSYSLHISNLTWEDSGLYNAQVNLKTSESHITKSYHLRVYRRLSKPHITVNSNISEEGVCNISLTCSIERAGMDVTYIWLSSQDSTNTSHEGSVLSTSWRPGDKAPSYTCRVSNPVSNISSRRISVGSFCADPGYPEKPSMLVDHHHHHH

Beschrijving

Source: Human Cells. MW :24.7kD. Recombinant Mouse SLAMF9 is produced by our Mammalian expression system and the target gene encoding Phe18-Leu230 is expressed

Specificaties

ProductnaamRecombinant Mouse SLAM Familielid 9/SLAMF9/CD2F-10 (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-7644-50