Recombinant Mouse Thymic Stromal Lymfopoëtine Receptor/TSP R (C-6His)
Gecertificeerd

Recombinant Mouse Thymic Stromal Lymfopoëtine Receptor/TSP R (C-6His)

Catalog #: 32-8605-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :23.7kD. Recombinant Mouse Thymic stromal lymphopoietin protein receptor is produced by our Mammalian expression system and the target gene encoding Ala20-Leu233 is expressed with a 6His tag at the C-terminus. The cytokine thymic stromal lymphopoietin receptor (TSLPR) is consisting of a common gamma receptor–like chain (TSLPR- gamma) and a common interleukin 7 (IL-7) R alpha chain that belongs to the type 1 cytokine receptor family. Transfection of TSLPR cDNA result in only low affinity binding, while cotransfection of the IL-7R alpha chain cDNA shows high affinity binding. TSLP and TSLPR play a critical role in the initiation of allergic diseases in mice. The TSLP R cDNA encodes a transmembrane receptor containing 370 amino acids (aa) with two potential N-linked glycosylation sites and a cytoplasmic domain of 104 aa including a single tyrosine residue. TSLPR can mediate signaling of the signal transducer and activator of transcription 5 (Stat5) by TSLP. TSLP R is broadly expressed in the immune and hematopoietic cells, particularly in hematopoietic progenitors and myeloid cells.

Gene Name

Crlf2

Gene ID

57914

UniProt

Q8CII9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AAAVTSRGDVTVVCHDLETVEVTWGSGPDHHSANLSLEFRYGTGALQPCPRYFLSGAGVTSGCILPAARAGLLELALRDGGGAMVFKARQRASAWLKPRPPWNVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPARCYDFRVRASPRAAHYGLEAQPSEWTAVTRLSGAASAASCTASPAPSPALAPPLVDHHHHHH

Beschrijving

Source: Human Cells. MW :23.7kD. Recombinant Mouse Thymic stromal lymphopoietin protein receptor is produced by our Mammalian expression system and the target g

Specificaties

ProductnaamRecombinant Mouse Thymic Stromal Lymfopoëtine Receptor/TSP R (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8605-50