Recombinant Mouse TRANCE/RANK L/TNFSF11 (C-6His)

Source: Human Cells. MW :28.5kD. Recombinant Mouse TNF-related Activation-induced Cytokine is produced by our Mammalian expression system and the target gene encoding Ala73-Asp316 is expressed with a 6His tag at the C-terminus. Mouse tumor necrosis factor ligand superfamily member 11 (Tnfsf11) is a member of the tumor necrosis factor (TNF) cytokine family. Tnfsf11 is widely expressed in cells including T cells and T cell rich organs, such as thymus and lymph nodes. This cytokine can bind to TNFRSF11B/OPG andTNFRSF11A/RANK. Tnfsf11 is involved in a number of fundamental biological processes such as acting as regulator of interactions between T-cells and dendritic cells, the regulation of the T-cell-dependent immune response and enhancing bone-resorption in humoral hypercalcemia of malignancy. It augments the ability of dendritic cells to stimulate naive T-cell proliferation.

Tnfsf11

21943

O35235

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

AQMDPNRISEDSTHCFYRILRLHENAGLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDIDVDHHHHHH