
Recombinant muis B7-H3/CD276 (C-6His)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source: Human Cells. MW :24.3kD. Recombinant Mouse B7 Homolog 3 is produced by our Mammalian expression system and the target gene encoding Val29-Phe244 is expressed with a 6His tag at the C-terminus. CD276, also known as B7-H3, is a member of the B7 superfamily with signature IgV and IgG regions in extracellular domains. It is a type I transmembrane protein and shares 20–27% amino acid identity with other B7 family members. B7-H3 is involved in the activation of T lymphocytes, and regulates murine bone formation. It is also reported that B7-H3 may play an important role in muscle-immune interactions, providing further evidence of the active role of muscle cells in local immunoregulatory processes. B7-H3 is expressed on T-cells, natural killer cells, and antigen presenting cells, as well as some non-immune cells, such as osteoblasts, fibroblasts, fibroblast-like synoviocytes and epithelial cells. High expression of B7-H3 in tumor vasculature also correlates with poor survival in patients, suggesting that it may play a role in tumor cell migration.
Cd276
102657
Q8VE98
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
The product is shipped on dry ice/ice packs.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFHHHHHH
Beschrijving
Source: Human Cells. MW :24.3kD. Recombinant Mouse B7 Homolog 3 is produced by our Mammalian expression system and the target gene encoding Val29-Phe244 is expr
Specificaties
Recent bekeken producten

Anti-TAT (Thrombin-antithrombin) Antibody
ABS 014-22-1
1000 µL

Anti-APOE2 mouse monoclonal antibody
TD-AB0132
100 µg

CD35 (CR1) mouse monoclonal antibody, clone J3D3, Azide Free
BM2364
0.2 mg

Anti-KIR2DL1 (Rabbit, Monoclonal, Rabbit mAb)
A115392
100 µL

Stains-all
03943-5
5 g

Sudan Blue II;Oil Blue 35
TRC-S688913-500MG
500 mg

Nile Blue A
N8430-01
1 g

Human Apolipoprotein E2 (Apo E2) Antibody
22210-05011
150 µg
