Recombinant muis Fc receptor-achtig eiwit 1/FCRL1/FcRH1 (C-6His)

Source: Human Cells. MW :22.5kD. Recombinant Mouse Fc receptor-like protein 1 is produced by our expression system and the target gene encoding Ala17-Ser219 is expressed with a 6His tag at the C-terminus. Mouse Fc receptor-like protein 1 (FCRL1) is a single-pass type I membrane protein. It is expressed in B-cells at the various stages of differentiation. Mouse FCRL1 consists of a 203 amino acid (aa) extracellular domain (ECD) with two Ig-like domains, a 21 aa transmembrane segment, and a 103 aa cytoplasmic domain with two immunotyrosine activation motifs (ITAMs) . FCRL1 is likely not a receptor for immunoglobulin. It may function as an activating coreceptor in B-cells and B-cells differentiation.

Fcrl1

229499

Q8R4Y0

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

The product is shipped on dry ice/ice packs.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

AGISDVSLKTRPPGGWVMEGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCAANDGHDPIASELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFYHESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPTENGISHLSHHHHHH