Recombinant muis S100 calciumbindeiwit A8/S100A8 (C-6His)
Gecertificeerd

Recombinant muis S100 calciumbindeiwit A8/S100A8 (C-6His)

Catalog #: 32-8352-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :11.3kD. Recombinant Mouse S100 Calcium Binding Protein A8 is produced by our E.coli expression system and the target gene encoding Met1-Glu89 is expressed with a 6His tag at the C-terminus. Protein S100-A8 (Mrp8) contains 2 EF-hand domains and belongs to the S-100 family. Mrp8 binds two calcium ions per molecule with an affinity similar to that of the S-100 proteins. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. It may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis.

Gene Name

S100a8

Gene ID

20201

UniProt

P27005

Components

Lyophilized from a 0.2 μm filtered solution of 20mMTris, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKELEHHHHHH

Beschrijving

Source: E. coli. MW :11.3kD. Recombinant Mouse S100 Calcium Binding Protein A8 is produced by our E.coli expression system and the target gene encoding Met1-Glu

Specificaties

ProductnaamRecombinant muis S100 calciumbindeiwit A8/S100A8 (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8352-50