
Recombinant muis Syndecaan-4/SDC4 (C-6His)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source: Human Cells. MW :14.4kD. Recombinant Mouse Syndecan-4 is produced by our Mammalian expression system and the target gene encoding Glu24-Glu145 is expressed with a 6His tag at the C-terminus. Mouse SDC4 is a ubiquitous transmembrane proteoglycan which belongs to the syndecan proteoglycan family. SDC4 is a cell surface proteoglycan that bears heparan sulfate. The four vertebrate syndecans, Syndecan-1 through -4, have similar short cytoplasmic domains and extracellular portions that diverge, except for HS attachment sites. Structurally diverse side chains add considerably to the size of the core proteins and serve as binding sites for growth factors, cytokines, and extracellular matrix proteins. Syndecans are present as homodimers or multimers, and are often expressed in developmental and cell type-specific patterns. It is expressed highly in liver, kidney and lung. SDC4 localizes to the focal adhesions of adherent cells and binds to a range of extracellular ligands, including growth factors and extracellular-matrix proteins. Through its extracellular domain, syndecan-4 cooperates with adhesion molecules and binds matrix components relevant for cell migration. As a heparan sulfate proteoglycan, SDC4 works as a coreceptor for various growth factors. Syn4 deficiency limits neointimal formation after vascular injury by regulating vascular smooth muscle cells (VSMCs) proliferation and vascular progenitor cells (VPCs) mobilization. SDC4 have an array of functions including regulating cell growth, differentiation, and adhesion.
Sdc4
20971
O35988
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
The product is shipped at ambient temperature.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEVDHHHHHH
Beschrijving
Source: Human Cells. MW :14.4kD. Recombinant Mouse Syndecan-4 is produced by our Mammalian expression system and the target gene encoding Glu24-Glu145 is expres
Specificaties
Recent bekeken producten

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Gabbr1 Mouse Monoclonal Antibody [Clone ID: S93A-49]
TA326530
100 µg

BSA-Myc/DDK Control Protein
AR100025
50 µL

NH-6
ABC-TC0826
1 Vial

Anti-TAT (Thrombin-antithrombin) Antibody
ABS 014-22-1
1000 µL

Anti-APOE2 mouse monoclonal antibody
TD-AB0132
100 µg

CD35 (CR1) mouse monoclonal antibody, clone J3D3, Azide Free
BM2364
0.2 mg

Anti-KIR2DL1 (Rabbit, Monoclonal, Rabbit mAb)
A115392
100 µL
Recent gezochte producten

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Fluorescein Conjugated Affinity Purified Anti-MOUSE IgG + IgM (H&L) (GOAT) Minimum Cross Reactivity to Bovine, Horse and Human S
GWB-5CB439
1 mg

Horse Polyclonal Horse anti-Goat IgG ImmPRESS(TM) Secondary Antibody [HRP Polymer]
MP-7405-NB-50mL
50 mL

Horse Polyclonal Horse anti-Rabbit IgG ImmPRESS(TM) Secondary Antibody [HRP Polymer]
MP-7401-NB-15mL
15 mL

Horse Polyclonal Horse anti-Mouse IgG ImmPRESS(TM) Secondary Antibody [AP Polymer]
MP-5402-NB-50mL
50 mL

Horse Polyclonal Horse anti-Goat IgG ImmPRESS(TM) Secondary Antibody [HRP Polymer]
MP-7405-NB-15mL
15 mL

Horse Polyclonal Horse anti-Mouse ImmPRESS(TM) VR Secondary Antibody [HRP Polymer]
MP-6402-NB
15 mL

Horse Polyclonal Horse anti-Mouse IgG ImmPRESS(TM) Secondary Antibody [AP Polymer]
MP-5402-NB-15mL
15 mL
