Recombinant muse Carbonic Ahydrase 14/CA14 (N-6His)
Gecertificeerd

Recombinant muse Carbonic Ahydrase 14/CA14 (N-6His)

Catalog #: 32-8596-10
Maat: 10 µg
Droogijs Vereist

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :32.3kD. Recombinant Mouse Carbonic anhydrase 14 is produced by our E.coli expression system and the target gene encoding Ala16-Met290 is expressed with a 6His tag at the N-terminus. Mouse Ca14, also known as Carbonic anhydrase 14, is a member of large family of zinc metalloenzymes .It could catalyze reversible hydration of carbon dioxide. The reaction is fundamental to many processes such as respiration, renal tubular acidification and bone resorption. Fifteen CA isoforms have been reported so far. They have different patterns of tissue-specific expression and physiologic roles. Some CAs may serve as markers for tumors and hypoxia. CA XIV is a polypeptide consisting of an extracellular N-terminal catalytic domain, a membrane-spanning segment and a short intracellular C- terminal segment with several potential phosphorylation sites. A subset of CAs lack CA activity due to point mutations but retain esterase function. CA14 is widely expressed in the central nervous system

Gene Name

Ca14

Gene ID

23831

UniProt

Q9WVT6

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM

Beschrijving

Source: E.coli. MW :32.3kD. Recombinant Mouse Carbonic anhydrase 14 is produced by our E.coli expression system and the target gene encoding Ala16-Met290 is exp

Specificaties

ProductnaamRecombinant muse Carbonic Ahydrase 14/CA14 (N-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8596-10