Recombinante Human Growth Differentiation Factor 11/GDF-11/BMP-11
Gecertificeerd

Recombinante Human Growth Differentiation Factor 11/GDF-11/BMP-11

Catalog #: 32-7654-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :12.6kD. Recombinant Human Growth differentiation factor 11 is produced by our Mammalian expression system and the target gene encoding Asn299-Ser407 is expressed. Growth/differentiation factor 11 (GDF-11) is a secreted protein, which belongs to the transforming growth factor beta superfamily. GDF-11 controls anterior-posterior patterning by regulating the expression of Hox genes. The secreted signal acts globally to specify positional identity along the anterior/posterior axis during development. GDF11 has been shown to suppress neurogenesis through a pathway similar to that of myostatin, including stopping the progenitor cell-cycle during G-phase. The similarities between GDF11 and myostatin imply a likelihood that the same regulatory mechanisms are used to control tissue size during both muscular and neural development.

Gene Name

GDF11

Gene ID

10220

UniProt

O95390

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Beschrijving

Source: Human Cells. MW :12.6kD. Recombinant Human Growth differentiation factor 11 is produced by our Mammalian expression system and the target gene encoding

Specificaties

ProductnaamRecombinante Human Growth Differentiation Factor 11/GDF-11/BMP-11
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7654-10