Recombinante Human Repulsive Guidance Molecule A/RGMA (N-6His)

Source: E. coli. MW :29.8kD. Recombinant Human Repulsive guidance molecule A is produced by our E.coli expression system and the target gene encoding Pro169-Gly422 is expressed with a 6His tag at the N-terminus. Repulsive guidance molecule A (RGMA) is a cell membrane protein and belongs to the repulsive guidance molecule (RGM) family. It interacts with NEO1, BMP2 and BMP4. RGMA is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. It helps guide Retinal Ganglion Cell (RGC) axons to the tectum in the midbrain. RGMa has been implicated to play an important role in the developing brain and in the scar tissue that forms after a brain injury. This protein may also function as a tumor suppressor in some cancers.

RGMA

56963

Q96B86

Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MNHKVHHHHHHMPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDLPG