Recombinante humane bloedplaatjes-aangedreven groeifactor AA/PDGF-AA (N-6His)
Gecertificeerd

Recombinante humane bloedplaatjes-aangedreven groeifactor AA/PDGF-AA (N-6His)

Catalog #: 32-8331-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :15.9kD. Recombinant Human Platelet-derived growth factor AA is produced by our E.coli expression system and the target gene encoding Ser87-Thr211 is expressed with a 6His tag at the N-terminus. Platelet-derived growth factor subunit A (PDGFA), belongs to the PDGF/VEGF growth factor family. PDGFA is a secreted protein, stored in platelet alpha-granules and released by platelets upon wounding. PDGFA is potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. It plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. PDGFA is required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis, normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. It plays an important role in wound healing; Signaling is modulated by the formation of heterodimers with PDGFB.

Gene Name

PDGFA

Gene ID

5154

UniProt

P04085

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

Beschrijving

Source: E. coli. MW :15.9kD. Recombinant Human Platelet-derived growth factor AA is produced by our E.coli expression system and the target gene encoding Ser87-

Specificaties

ProductnaamRecombinante humane bloedplaatjes-aangedreven groeifactor AA/PDGF-AA (N-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8331-50