
Recombinante humane fibroblast groeifactor 21/FGF-21 (N-6His)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source: E.coli. MW :21.69kD. Recombinant Human Fibroblast Growth Factor 21 is produced by our E.coli expression system and the target gene encoding His29-Ser209 is expressed with a 6His tag at the N-terminus. Fibroblast Growth Factor 21 (FGF21) is a growth factor that belongs to the FGF family. FGF family proteins play a central role during prenatal development and postnatal growth and regeneration of mamy tissues, by promoting cellular proliferation and differentiation. FGF21 is a potent activator of glucose uptake on adipocytes, protects animal from diet-induced obesity when overexpression in transgenic mice, and lower blood glucose and triglyceride levels when therapeutically adiministered to diabetic redents. FGF21 is produced by hepatocytes in reponse to free fatty acid stimulation of a PPARa/RXR dimeric complex. This situation occurs clinically during starvation, or following the ingestionof a highly-fat/low-carbohydrate diet.Upon FGF21 secretion, white adipose tissue is induced to release free fatty acids from triglyceride stores. Once free fatty acid reach hepatocytes, they are oxidized and reduced to acetyl-CoA. The acetyl-CoA is recombined into 4-carbon ketone bodies, release, and transported to peripheral tissue for TCA processing and energy generation.
FGF21
26291
Q9NSA1
Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, 2mM EDTA, pH9.0 .
The product is shipped at ambient temperature.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
MGSSHHHHHHSSGLVPRGSHMHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Beschrijving
Source: E.coli. MW :21.69kD. Recombinant Human Fibroblast Growth Factor 21 is produced by our E.coli expression system and the target gene encoding His29-Ser209
Specificaties
Recent bekeken producten

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Gabbr1 Mouse Monoclonal Antibody [Clone ID: S93A-49]
TA326530
100 µg

BSA-Myc/DDK Control Protein
AR100025
50 µL

NH-6
ABC-TC0826
1 Vial

Anti-TAT (Thrombin-antithrombin) Antibody
ABS 014-22-1
1000 µL

Anti-APOE2 mouse monoclonal antibody
TD-AB0132
100 µg

CD35 (CR1) mouse monoclonal antibody, clone J3D3, Azide Free
BM2364
0.2 mg

Anti-KIR2DL1 (Rabbit, Monoclonal, Rabbit mAb)
A115392
100 µL
Recent gezochte producten

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Fluorescein Conjugated Affinity Purified Anti-MOUSE IgG + IgM (H&L) (GOAT) Minimum Cross Reactivity to Bovine, Horse and Human S
GWB-5CB439
1 mg

Horse Polyclonal Horse anti-Goat IgG ImmPRESS(TM) Secondary Antibody [HRP Polymer]
MP-7405-NB-50mL
50 mL

Horse Polyclonal Horse anti-Rabbit IgG ImmPRESS(TM) Secondary Antibody [HRP Polymer]
MP-7401-NB-15mL
15 mL

Horse Polyclonal Horse anti-Mouse IgG ImmPRESS(TM) Secondary Antibody [AP Polymer]
MP-5402-NB-50mL
50 mL

Horse Polyclonal Horse anti-Goat IgG ImmPRESS(TM) Secondary Antibody [HRP Polymer]
MP-7405-NB-15mL
15 mL

Horse Polyclonal Horse anti-Mouse ImmPRESS(TM) VR Secondary Antibody [HRP Polymer]
MP-6402-NB
15 mL

Horse Polyclonal Horse anti-Mouse IgG ImmPRESS(TM) Secondary Antibody [AP Polymer]
MP-5402-NB-15mL
15 mL
