Recombinante humane galneurofische factor/CNTF

Source: E.coli. MW :22.93kD. Recombinant Human CNTF is produced by our E.coli expression system and the target gene encoding Ala2-Met200 is expressed. Ciliary Neurotrophic Factor (CNTF) is a potent survival factor for neurons and oligodendrocytes. CNTF has also been shown to prevent the degeneration of motor axons after axotomy. CNTF is highly conserved across species and exhibits cross-species activities. Human and rat CNTF share approximately 83% homology in their protein sequence. CNTF is structurally related to IL6, IL11, LIF and OSM. All of these four helix bundle cytokines share gp130 as a signal transducing subunit in their receptor complexes. CNTF, like FGF acidic, FGF basic, and PD-ECGF (platelet-derived endothelial cell growth factor), does not possess a signal sequence that would allow secretion of the factor by classical secretion pathways. The mechanism underlying the release of CNTF is unknown.

CNTF

1270

P26441

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM Cysteine, pH 7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM