Recombinante humane MOB Kinase Activator 1A/MOB1A (C-6His)

Source: E.coli. MW :26kD. Recombinant Human MOB Kinase Activator 1A is produced by our E.coli expression system and the target gene encoding Ser2-Arg216 is expressed with a 6His tag at the C-terminus. MOB Kinase Activator 1A (MOB1A) belongs to the MOB1/phocein family, which acts as an activator of LATS1/2 in the Hippo signaling pathway, plays a key role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. MOBKL1B stimulates the kinase activity of STK38 and STK38L. MOBKL1B binds to and regulate downstream targets such as the NDR-family protein kinases and LATS1 kinase.

MOB1A

55233

Q9H8S9

Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 0.15M NaCl, pH 8.0 .

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

SFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDRLEHHHHHH