Recombinante humane receptor Tyrosine kinase MerTK/MERTK/MER (C-6His)
Gecertificeerd

Recombinante humane receptor Tyrosine kinase MerTK/MERTK/MER (C-6His)

Catalog #: 32-8472-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :36kD. Recombinant Human Tyrosine-protein kinase Mer is produced by our Mammalian expression system and the target gene encoding Met177-Ala499 is expressed with a 6His tag at the C-terminus. Tyrosine-protein kinase Mer (MERTK) is a single-pass type I membrane protein which belongs to the MER/AXL/TYRO3 receptor kinase family. MERTK include two fibronectin type-III domains, two Ig-like C2-type domains, and one tyrosine kinase domain. It canâ€TMt be expressed in normal B- and T-lymphocytes, but it is usually expressed in numerous neoplastic B- and T-cell lines. MERTK could regulate many physiological processes, such as cell survival, migration, differentiation. It was demonstrated that the MERTK plays critical role in the engulfment and efficient clearance of apoptotic cells, platelet aggregation, and cytoskeleton reorganization. Not only these, it also plays an important role in inhibition of Toll-like receptors (TLRs) -mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3. In addition, MERTK could regulate rod outer segments fragments phagocytosis in the retinal pigment epithelium (RPE), deficiency in MERTK are the cause of retinitis pigmentosa.

Gene Name

MERTK

Gene ID

10461

UniProt

Q12866

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTKGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNAVDHHHHHH

Beschrijving

Source: Human Cells. MW :36kD. Recombinant Human Tyrosine-protein kinase Mer is produced by our Mammalian expression system and the target gene encoding Met177-

Specificaties

ProductnaamRecombinante humane receptor Tyrosine kinase MerTK/MERTK/MER (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8472-50