Recombinante humane Ribulose-Fosphaat 3-Epimerase/RPE (C-6His)

Source: E. coli. MW :25.9kD. Recombinant Human Ribulose-Phosphate 3-Epimerase is produced by our E.coli expression system and the target gene encoding Met1-Arg228 is expressed with a 6His tag at the C-terminus. Ribulose-Phosphate 3-Epimerase (RPE) is a member of the Ribulose-Phosphate 3-Epimerase family. RPE exists as a homodimer and catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. RPE binds one divalent metal cation per subunit and contains tightly bound Fe2+ when produced in E. coli, but the physiological cofactor may be Co2+, Mn2+ or Zn2+. It has been shown that RPE participates in 3 metabolic pathways: pentose phosphate pathway, pentose and glucuronate interconversions, and carbon fixation.

RPE

6120

Q96AT9

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 6.2.

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDRVDHHHHHH