Recombinante humane transcriptional repressor CTCF/CTCF
Gecertificeerd

Recombinante humane transcriptional repressor CTCF/CTCF

Catalog #: 32-8139-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :16.9kD. Recombinant Human CCCTC-Binding Factor is produced by our E.coli expression system and the target gene encoding Met1-Ile154 is expressed. Transcriptional Repressor CTCF (CTCF) belongs to the CTCF Zinc-Finger Protein family. CTCF contains twelve C2H2-type zinc fingers and interacts with CHD8. CTCF is widely expressed in many tissues, and it is absent in primary spermatocytes. CTCF is involved in transcriptional regulation by binding to chromatin insulators and preventing interaction between promoter and nearby enhancers and silencers. CTCF plays an essential role in oocyte and preimplantation embryo development by activating or repressing transcription. In addition, CTCF is also indispensable in the epigenetic regulation and chromatin remodeling.

Gene Name

CTCF

Gene ID

10664

UniProt

P49711

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMI

Beschrijving

Source: E. coli. MW :16.9kD. Recombinant Human CCCTC-Binding Factor is produced by our E.coli expression system and the target gene encoding Met1-Ile154 is expr

Specificaties

ProductnaamRecombinante humane transcriptional repressor CTCF/CTCF
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8139-10