Recombinante humane Tumor Necrosis Factor Receptor II/TNFRSF1B/CD120b (C-6His)
Gecertificeerd

Recombinante humane Tumor Necrosis Factor Receptor II/TNFRSF1B/CD120b (C-6His)

Catalog #: 32-8419-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :26.2kD. Recombinant Human Tumor Necrosis Factor Receptor II is produced by our Mammalian expression system and the target gene encoding Leu23-Asp257 is expressed with a 6His tag at the C-terminus. Tumor necrosis factor receptor superfamily member 1B is a 461 amino acids protein that belongs to the TNFR (tumor necrosis factor receptor) superfamily characterized by cysteine-rich extracellular domains. It contains 4 TNFR-Cys repeats. TNFRII is expressed in fetal brain. TNFRII is strongly expressed at the cartilage-pannus junction, and plays a major role in a subset of families with multiple cases of rheumatoid arthritis (RA) . This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.

Gene Name

TNFRSF1B

Gene ID

7133

UniProt

P20333

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDVDHHHHHH

Beschrijving

Source: Human Cells. MW :26.2kD. Recombinant Human Tumor Necrosis Factor Receptor II is produced by our Mammalian expression system and the target gene encoding

Specificaties

ProductnaamRecombinante humane Tumor Necrosis Factor Receptor II/TNFRSF1B/CD120b (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8419-50