Recombinante Mouse Fibroblast growth Factor 1/FGF-1/FGFa (Phe16-Asp155)
Gecertificeerd

Recombinante Mouse Fibroblast growth Factor 1/FGF-1/FGFa (Phe16-Asp155)

Catalog #: 32-7036-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :15.7kD. Recombinant Mouse Fibroblast growth factor 1 is produced by our E.coli expression system and the target gene encoding Phe16-Asp155 is expressed. FGF acidic is a 17 kDa nonglycosylated member of the FGF family of mitogenic peptides. FGF acidic, which is produced by multiple cell types, stimulates the proliferation of all cells of mesodermal origin and many cells of neuroectodermal, ectodermal, and endodermal origin. It plays a number of roles in development, regeneration, and angiogenesis. FGF-acidic is a non-glycosylated heparin binding growth factor that is expressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes and endothelial cells. FGF-acidic has the ability to signal through all the FGF receptors.

Gene Name

Fgf1

Gene ID

14164

UniProt

P61148

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 500mM NaCl, pH 6.6.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is less than 0.5 ng/ml. Specific Activity of 2.0 x 10^6 IU/mg.

Amino Acids

FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Beschrijving

Source: E.coli. MW :15.7kD. Recombinant Mouse Fibroblast growth factor 1 is produced by our E.coli expression system and the target gene encoding Phe16-Asp155 i

Specificaties

ProductnaamRecombinante Mouse Fibroblast growth Factor 1/FGF-1/FGFa (Phe16-Asp155)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7036-10