Recombinante muis C-C motief chemocine 2/CCL2 (C-6His)

Source: Human cells. MW :14.7kD. Recombinant Mouse C-C motif chemokine 2 is produced by our Mammalian expression system and the target gene encoding Gln24-Asn148 is expressed with a 6His tag at the C-terminus. C-C motif chemokine 2 (CCL2) is a member of the C-C or beta chemokine family. Mouse CCL2 shares 82% amino acid (aa) identity with rat CCL2 over the entire sequence, and 58%, 56%, 55%, 53% and 53% aa identity with human, equine, porcine, bovine and canine CCL2, respectively. Fibroblasts, glioma cells, smooth muscle cells, endothelial cells, lymphocytes and mononuclear phagocytes can produce CCL2 either constitutively or upon mitogenic stimulation, but monocytes and macrophages appear to be the major source. In addition to its chemotactic activity, CCL2 induces enzyme and cytokine release by monocytes, NK cells and lymphocytes, and histamine release by basophils that express its receptor, CCR2. Additionally, it promotes Th2 polarization in CD4+ T cells. CCL2-mediated recruitment of monocytes to sites of inflammation is proposed to play a role in the pathology of atherosclerosis, multiple sclerosis and allergic asthma.

Ccl2

20296

P10148

Supplied as a 0.2 μm filtered solution of 20mM Tris, 500mM NaCl, 10% glycerol, pH7.4 .

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVNHHHHHH