Recombinante muis die groeifactor beta-2/TGF beta2/TGFB2 transformeert

Source: Human Cells. MW :12.7kD. Recombinant Mouse Transforming Growth Factor beta 2 is produced by our Mammalian expression system and the target gene encoding Ala303-Ser414 is expressed. Transforming growth factor beta 2 (TGF- beta2) is a member of TGF-beta superfamily that shares a characteristic cysteine knot structure. Mice with TGF- beta2 gene deletion show defects in development of cardiac, lung, craniofacial, limb, spinal column, eye, inner ear and urogenital systems. All TGF- beta isoforms signal via the same heteromeric receptor complex, consisting of a ligand binding TGF- beta receptor type II (T betaR-II), and a TGF- beta receptor type I (T betaR-I) . Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF- beta expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.

Tgfb2

21808

P27090

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS