
Recombinante muis SLAMF4/Natuurlijke killercelreceptor 2B4/CD244 (C-6His)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source: Human cells. MW :23.5kD. Recombinant Mouse Natural killer cell receptor 2B4 is produced by our Mammalian expression system and the target gene encoding Gln20-Asn221 is expressed with a 6His tag at the C-terminus. Natural killer cell receptor 2B4 (2B4/CD244) is is a 66 kDa type I transmembrane glycoprotein in the SLAM subgroup of the CD2 protein family. SLAM family proteins have an extracellular domain (ECD) with two or four Ig-like domains and at least two cytoplasmic immunoreceptor tyrosine-based switch motifs (ITSMs) . 2B4 interacts with CD48, while other SLAM family proteins interact in a homophilic manner. The mouse 2B4 cDNA encodes a 397 amino acid (aa) precursor that includes a 19 aa signal sequence, a 207 aa ECD with one Ig-like V-type and one C2-type Ig-like domain, a 21 aa transmembrane segment, and a 150 aa cytoplasmic domain with four ITSMs. Within the ECD, mouse 2B4 shares 46% and 68% aa sequence identity with human and rat 2B4, respectively. 2B4/CD48 signaling cooperates with other receptor systems to either promote or inhibit NK and CD8+ T cell activation. The inhibitory activities are distinct from those of MHC I restricted inhibitory NK cell receptors. Ligation of 2B4 with antibodies or CD48 constructs can directly trigger inhibitory signaling or disrupt an inhibitory interaction, leading to cellular activation. 2B4 can also induce signaling through CD48.
Cd244
18106
Q07763
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
The product is shipped at ambient temperature.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
QDCPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFTHGCQSVPSNHHHHHH
Beschrijving
Source: Human cells. MW :23.5kD. Recombinant Mouse Natural killer cell receptor 2B4 is produced by our Mammalian expression system and the target gene encoding
Specificaties
Recent bekeken producten

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Gabbr1 Mouse Monoclonal Antibody [Clone ID: S93A-49]
TA326530
100 µg

BSA-Myc/DDK Control Protein
AR100025
50 µL

NH-6
ABC-TC0826
1 Vial

Anti-TAT (Thrombin-antithrombin) Antibody
ABS 014-22-1
1000 µL

Anti-APOE2 mouse monoclonal antibody
TD-AB0132
100 µg

CD35 (CR1) mouse monoclonal antibody, clone J3D3, Azide Free
BM2364
0.2 mg

Anti-KIR2DL1 (Rabbit, Monoclonal, Rabbit mAb)
A115392
100 µL
Recent gezochte producten

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Fluorescein Conjugated Affinity Purified Anti-MOUSE IgG + IgM (H&L) (GOAT) Minimum Cross Reactivity to Bovine, Horse and Human S
GWB-5CB439
1 mg

Horse Polyclonal Horse anti-Goat IgG ImmPRESS(TM) Secondary Antibody [HRP Polymer]
MP-7405-NB-50mL
50 mL

Horse Polyclonal Horse anti-Rabbit IgG ImmPRESS(TM) Secondary Antibody [HRP Polymer]
MP-7401-NB-15mL
15 mL

Horse Polyclonal Horse anti-Mouse IgG ImmPRESS(TM) Secondary Antibody [AP Polymer]
MP-5402-NB-50mL
50 mL

Horse Polyclonal Horse anti-Goat IgG ImmPRESS(TM) Secondary Antibody [HRP Polymer]
MP-7405-NB-15mL
15 mL

Horse Polyclonal Horse anti-Mouse ImmPRESS(TM) VR Secondary Antibody [HRP Polymer]
MP-6402-NB
15 mL

Horse Polyclonal Horse anti-Mouse IgG ImmPRESS(TM) Secondary Antibody [AP Polymer]
MP-5402-NB-15mL
15 mL
