Recombinante muis Tumor Necrosis Factor Receptor I/TNFRSF1A/CD120a
Gecertificeerd

Recombinante muis Tumor Necrosis Factor Receptor I/TNFRSF1A/CD120a

Catalog #: 32-8246-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :21.2kD. Recombinant Mouse Tumor Necrosis Factor Receptor I is produced by our E.coli expression system and the target gene encoding Ile22-Ala212 is expressed. Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a) is a member of the tumor necrosis factor receptor superfamily. Tnfrsf1a is one of the major receptors for the tumor necrosis factor-alpha. It can activate the transcription factor NF-?B, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the human genetic disorder called tumor necrosis factor associated periodic syndrome (TRAPS) or periodic fever syndrome.

Gene Name

Tnfrsf1a

Gene ID

21937

UniProt

P25118

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MIHPSGVTGLVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQADKDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQDSGTA

Beschrijving

Source: E. coli. MW :21.2kD. Recombinant Mouse Tumor Necrosis Factor Receptor I is produced by our E.coli expression system and the target gene encoding Ile22-A

Specificaties

ProductnaamRecombinante muis Tumor Necrosis Factor Receptor I/TNFRSF1A/CD120a
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8246-50