Recombinante muse Carbonische Anhydrase 12/CA12 (C-6His)
Gecertificeerd

Recombinante muse Carbonische Anhydrase 12/CA12 (C-6His)

Catalog #: 32-8637-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :32.4kD. Recombinant Mouse Carbonic Anhydrase 12 is produced by our Mammalian expression system and the target gene encoding Ala25-Ser301 is expressed with a 6His tag at the C-terminus. Carbonic Anhydrase (CA) XII, also known as Car12 and CA12, is an extracellular enzyme involved in the regulation of the microenvironment acidity and tumor malignant phenotype, was originally identified as a protein overexpressed in some types of cancers. It has showed that CA XII is induced by hypoxia and oestrogen and expressed at high levels on various types of cancer. The enzyme is directly involved in tumour progression, and its inhibition has an anti-tumour effect. Apart from its role in carcinogenesis, the enzyme contributes to various other diseases like glaucoma and arteriosclerotic plaques, among others. CA XII is therefore regarded as promising target for specific therapies, and may be used as a novel prognostic marker in combination with histologic grade of the tumors.

Gene Name

Ca12

Gene ID

76459

UniProt

Q8CI85

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APLNGSKWTYVGPAGEKNWSKKYPSCGGLLQSPIDLHSDILQYDASLAPLQFQGYNVSVEKLLNLTNDGHSVRLNLNSDMYIQGLQPHHYRAEQLHLHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDLYPDFSTASDKSEGLAVLAVLIEIGSANPSYDKIFSHLQHVKYKGQQVLIPGFNIEELLPESPGEYYRYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMDDPTPREMINNFRQVQKFDERLVYISFRQGLLTDTGLSVDHHHHHH

Beschrijving

Source: Human Cells. MW :32.4kD. Recombinant Mouse Carbonic Anhydrase 12 is produced by our Mammalian expression system and the target gene encoding Ala25-Ser30

Specificaties

ProductnaamRecombinante muse Carbonische Anhydrase 12/CA12 (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8637-10