RHBDL2 Antilichaam - N-terminalgebied: FITC (ARP47357 P050-FITC)

Rhomboid, veinlet-like 2 (Drosophila)

RRP2

54933

Q9NX52

NP_060291

Human, Rat, Cow, Dog, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human RHBDL2

RHBDL2 is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. RHBDL2 is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3.The protein encoded by this gene is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. The encoded protein is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3.

EFNB3; EFNB2

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 79%; Dog: 86%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 86%; Rat: 85%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

34kDa

Gregory, S.G., (2006) Nature 441 (7091), 315-321

Wet Ice

303

RHBDL2

RHBDL2

Rabbit

Rhomboid-related protein 2

NM_017821

KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT