RhoA Rabbit pAb (APR20508N)

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RhoA Rabbit pAb (APR20508N) .

ARH12; ARHA; RHO12; RHOH12; Rho; RHOA; RhoA

387

P61586

Cell membrane, Cell projection, Cleavage furrow, Cytoplasm, Cytoplasmic side, Lipid-anchor, Midbody, cell cortex, cytoskeleton, lamellipodium

WB (Homo sapiens)

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IP 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 21kDa Observed MW: 21KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=387

https://www.uniprot.org/uniprot/P61586

KPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL