RNF38 Antilichaam - N-terminaal gebied: Biotine (ARP43304_T100-Biotine)

Ring finger protein 38

FLJ21343

152006

A6PVQ0

NP_919310

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human RNF38

RNF38 is a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis.This gene encodes a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

RNF38; UBE2D2; TP53; DTX3; UBC; RNF114; DZIP3; LDB1; ELAVL1; UBE2D4; TP63; UBE2H; UBE2D3; UBE2D1; TP73

Biotin

Polyclonal Antibody

WB

RNF38 is supported by BioGPS gene expression data to be expressed in Jurkat

0.5 mg/ml

Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

51kDa

Kimura, K., (2006) Genome Res. 16 (1), 55-65

Wet Ice

465

RNF38

RNF38

Rabbit

NM_194329

FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP