RNF6 Antilichaam - C-terminal regio : HRP (ARP43065_P050-HRP)

Ring finger protein (C3H2C3 type) 6

DKFZp686P0776

6049

Q9Y252

NP_005968

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the C terminal region of human RNF6

RNF6 contains a RING-H2 finger motif. Deletions and mutations in this gene were detected in esophageal squamous cell carcinoma (ESCC), suggesting that this protein may be a potential tumor suppressor. Studies of the mouse counterpart suggested a role of this protein in the transcription regulation that controls germinal differentiation. The protein encoded by this gene contains a RING-H2 finger motif. Deletions and mutations in this gene were detected in esophageal squamous cell carcinoma (ESCC), suggesting that this protein may be a potential tumor suppressor. Studies of the mouse counterpart suggested a role of this protein in the transcription regulation that controls germinal differentiation. Multiple alternatively spliced transcript variants encoding the same protein are observed.

UBE2D1; AR; LDB1; UBC; tat; UBE2H

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

There is BioGPS gene expression data showing that RNF6 is expressed in HEK293T

0.5 mg/ml

Cow: 86%; Dog: 93%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 86%; Rat: 92%; Zebrafish: 79%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

78kDa

Tursun, B., (2005) Genes Dev. 19 (19), 2307-2319

Wet Ice

685

RNF6

RNF6

Rabbit

E3 ubiquitin-protein ligase RNF6

NM_005977

VETGTLPILRLAHFFLLNESDDDDRIRGLTKEQIDNLSTRHYEHNSIDSE