RPL10A Antilichaam - middengebied: FITC (ARP56728 P050-FITC)

Ribosomal protein L10a

L10A, CSA19, NEDD6, Csa-19

4736

P62906

NP_009035

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human RPL10A

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm. The expression of this gene is downregulated in the thymus by cyclosporin-A (CsA), an immunosuppressive drug. Studies in mice have shown that the expression of the ribosomal protein L10a gene is downregulated in neural precursor cells during development. This gene previously was referred to as NEDD6 (neural precursor cell expressed, developmentally downregulated 6), but it has been renamed RPL10A (ribosomal protein 10a) . As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

RGS17; HUWE1; CEP250; TUBG1; TP53; UBC; MDM2; RNF2; TARDBP; YWHAQ; PAN2; UBL4A; VCAM1; SRPR; ITGA4; FN1; ACTB; ESR1; RPLP0P6; RPL10L; RAD18; RPS27L; RPL23; RPL14; S100A10; RPS28; RPS27A; RPS26; RPS25; RPS24; RPS23; RPS21; RPS20; RPS19; RPS16; RPS15A; RPS1

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

25kDa

Wet Ice

217

RPL10A

RPL10A

Rabbit

60S ribosomal protein L10a

NM_007104

YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK