RPS15A Antilichaam - middengebied: FITC (ARP56227 P050-FITC)

Ribosomal protein S15a

S15a, DBA20

6210

P62244

NP_001025180

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human RPS15A

The specific function of this protein remains unknown.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S8P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

HUWE1; CEP57; TUBG1; CEP76; CEP250; UBC; ZBTB1; RNF2; PSMD11; PSMD3; PSMD1; PSMC6; PSMC1; FAU; WIBG; WDR26; PNO1; TSR1; RPS27L; RPS29; RPS28; RPS27; RPS26; RPS25; RPS24; RPS23; RPS2; RPS21; RPS20; RPS19; RPS18; RPS16; RPS14; RPS13; RPS12; RPS10; RPS9; RPS

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

15kDa

Yu, Y., (2005) Protein Sci. 14 (6), 1438-1446

Wet Ice

130

RPS15A

RPS15A

Rabbit

40S ribosomal protein S15a

NM_001030009

KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH