RPS24 Antilichaam - middengebied: FITC (ARP40304 P050-FITC)

Ribosomal protein S24

S24, DBA3, eS24

6229

P62847

NP_001017

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human RPS24

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro

HUWE1; TP53; UBC; MDM2; EED; RNF2; NUP188; SPTAN1; RPS29; RPS28; RPS27; RPS26; RPS25; RPS23; RPS20; RPS19; RPS18; RPS16; RPS15A; RPS14; RPS13; RPS12; RPS11; RPS10; RPS9; RPS8; RPS7; RPS6; RPS5; RPS4X; RPS3A; EIF3CL; PRUNE2; WIBG; EIF2A; WDR26; PNO1; TSR1

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

RPS24 is supported by BioGPS gene expression data to be expressed in OVCAR3

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

15kDa

Choesmel, V., (2008) Hum. Mol. Genet. 17 (9), 1253-1263

Wet Ice

133

RPS24

RPS24

Rabbit

40S ribosomal protein S24

NM_001026

GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT