RPS3A Antilichaam - N-terminaal gebied: Biotine (ARP56138 P050-Biotine)

Ribosomal protein S3A

S3A, FTE1, MFTL

6189

P61247

NP_000997

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the N terminal region of human RPS3A

RPS3A may play a role during erythropoiesis through regulation of transcription factor DDIT3.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S3AE family of ribosomal proteins. It is located in the cytoplasm. Disruption of the gene encoding rat ribosomal protein S3a, also named v-fos transformation effector protein, in v-fos-transformed rat cells results in reversion of the transformed phenotype. Transcript variants utilizing alternative transcription start sites have been described. This gene is co-transcribed with the U73A and U73B small nucleolar RNA genes, which are located in its fourth and third introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

HUWE1; UBC; TP53; VCP; TUBG1; AURKA; SUMO2; NEDD1; CEP76; TUBGCP4; CEP250; CEP57; RPA3; RPA2; RPA1; RPS17; RNF2; rev; RPS29; RPS28; RPS27; RPS26; RPS25; RPS24; RPS23; RPS21; RPS20; RPS19; RPS18; RPS16; RPS15A; RPS14; RPS13; RPS12; RPS10; RPS9; RPS8; RPS7

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

30kDa

Olsen, J.V., (2006) Cell 127 (3), 635-648

Wet Ice

264

RPS3A

RPS3A

Rabbit

40S ribosomal protein S3a

NM_001006

APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF