Rybp Antibody - N-terminal regio : HRP (ARP37264 P050-HRP)

RING1 and YY1 binding protein

DEDA, DEDAF, YEAF1, 2410018J24Rik

56353

Q8CCI5

NP_062717

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rybp

Rybp inhibits ubiquitination and subsequent degradation of TP53, and thereby plays a role in regulating transcription of TP53 target genes. It may be implicated in the regulation of the transcription as a repressor of the transcriptional activity of E4TF1 and may bind to DNA. It promotes apoptosis.

Eed; Nanog; Pcgf1; Kdm2b; Rnf2; L3mbtl2; Pcgf6; Rybp; Pcgf2; Ring1; UBC; Tfcp2l1; Pou5f1

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 92%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 75%; Zebrafish: 85%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

25kDa

Wet Ice

228

RYBP

Rybp

Rabbit

RING1 and YY1-binding protein

NM_019743

RINSQLVAQQVAQQYATPPPPKKEKKEKVEKPDKEKPEKDKDISPSVTKK