S100A3 Antilichaam - N-terminalgebied: FITC (ARP42084_T100-FITC)

S100 calcium binding protein A3

S100E

6274

P33764

NP_002951

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human S100A3

S100A3 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.

S100A3; DLG3

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

IHC, WB

S100A3 is supported by BioGPS gene expression data to be expressed in OVCAR3

0.5 mg/ml

Cow: 82%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

11kDa

Kizawa, K., (2002) Biochem. Biophys. Res. Commun. 299 (5), 857-862

Wet Ice

101

S100A3

S100A3

Rabbit

Protein S100-A3

NM_002960

MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF