SCN7A Antilichaam - N-terminaal gebied: Biotine (ARP35113 P050-Biotine)

Sodium voltage-gated channel alpha subunit 7

NaG, SCN6A, Nav2.1, Nav2.2

6332

Q01118

NP_002967.2

Human, Mouse, Rat, Dog, Guinea Pig

The immunogen is a synthetic peptide directed towards the N-terminal region of human SCN7A

This gene encodes one of the many voltage-gated sodium channel proteins. For proper functioning of neurons and muscles during action potentials, voltage-gated sodium channels direct sodium ion diffusion for membrane depolarization. This sodium channel protein has some atypical characteristics; the similarity between the human and mouse proteins is lower compared to other orthologous sodium channel pairs. Also, the S4 segments, which sense voltage changes, have fewer positive charged residues that in other sodium channels; domain 4 has fewer arginine and lysine residues compared to other sodium channel proteins. Several alternatively spliced transcript variants exist, but the full-length natures of all of them remain unknown.

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Dog: 79%; Guinea Pig: 80%; Human: 100%; Mouse: 79%; Rat: 79%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

83kDa

Wet Ice

762

SCN7A

SCN7A

Rabbit

Sodium channel protein type 7 subunit alpha

NM_002976.3

PFIYGNLSQGMVSEPLEDVDPYYYKKKNTFIVLNKNRTIFRFNAASILCT