SELENON Antibody - C-terminal regio : FITC (ARP47657 P050-FITC)

Selenoprotein N

Se, SelN, Sepn1, AI414492, 1110019I12Rik

74777

D3Z5N3

NP_083376

Human, Mouse, Rat, Cow, Guinea Pig, Horse

The immunogen is a synthetic peptide corresponding to a region of Mouse

This gene encodes a glycoprotein that is localized in the endoplasmic reticulum. It plays an important role in cell protection against oxidative stress, and in the regulation of redox-related calcium homeostasis. Mutations in the orthologous gene in human are associated with early onset muscle disorders, referred to as SEPN1-related myopathy. Knockout mice deleted for this gene exhibit abnormal lung development. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec) . Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. A second stop-codon redefinition element (SRE) adjacent to the UGA codon has been identified in this gene (PMID:15791204) . SRE is a phylogenetically conserved stem-loop structure that stimulates readthrough at the UGA codon, and augments the Sec insertion efficiency by SECIS.

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB, IHC

Affinity Purified

0.5 mg/ml

Cow: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rat: 86%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

62kDa

Wet Ice

557

SELENON

SELENON

Rabbit

Selenoprotein N

NM_029100

VHHINANYFLDITSMKPEDMENNNVFSFSSSFEDPSTATYMQFLREGLRR