SERPINB6 Antilichaam - middengebied HRP (ARP59249 P050-HRP)

Serpin peptidase inhibitor, clade B (ovalbumin), member 6

CAP, PI6, PTI, PI-6, SPI3, DFNB91, MSTP057

5269

P35237

NP_004559

Human, Cow

The immunogen is a synthetic peptide directed towards the middle region of human SERPINB6

The protein encoded by this gene is a member of the serpin (serine proteinase inhibitor) superfamily, and ovalbumin (ov) -serpin subfamily. It was originally discovered as a placental thrombin inhibitor. The mouse homolog was found to be expressed in the hair cells of the inner ear. Mutations in this gene are associated with nonsyndromic progressive hearing loss, suggesting that this serpin plays an important role in the inner ear in the protection against leakage of lysosomal content during stress, and that loss of this protection results in cell death and sensorineural hearing loss. Alternatively spliced transcript variants have been found for this gene.

SUMO2; C16orf70; AHCY; CRK; UBC; F10; PLAU; F2; PROC; PLG; KLK2

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 79%; Human: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

41kDa

Wet Ice

376

SERPINB6

SERPINB6

Rabbit

Serpin B6

NM_004568

LVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTY