SFPI1 Antilichaam - N-terminal regio : HRP (ARP37890_T100-HRP)

SFFV proviral integration 1

Sf, Sp, Dis, PU., Sfp, Dis1, PU.1, Dis-1, Sfpi1, Spi-1, Tcfpu, Tfpu., Sfpi-1, Tcfpu1, Tfpu.1

20375

P17433

NP_035485

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the N terminal region of mouse SFPI1

Sfpi1 binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. Sfpi1 is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. Sfpi1 also binds RNA and may modulate pre-mRNA splicing.

Prdm1; Jun; Hoxa10; Ep300; Kat6a; Irf4; Pml; Trim33; Cbfa2t3; Sin3a; Hdac2; Id2; Gata1; Emx1; Crebbp; Gata3; Csf1r; Il7r

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

0.5 mg/ml

Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 79%; Mouse: 100%; Rabbit: 86%; Rat: 93%; Zebrafish: 86%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

30kDa

McDevit, D.C. (2006) Mol. Immunol. 43 (10), 1541-1548

Wet Ice

272

SPI1

Spi1

Rabbit

Transcription factor PU.1

NM_011355

NEFENFPENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHTGLSH