SGMS2 Antilichaam - N-terminaal gebied: Biotine (ARP53077 P050-Biotine)

Sphingomyelin synthase 2

CDL, SMS2

166929

Q8NHU3

NP_689834

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the N terminal region of human SGMS2

SGMS2 is a bidirectional lipid cholinephosphotransferase capable of converting phosphatidylcholine (PC) and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. Direction is dependent on the relative concentrations of DAG and ceramide as phosphocholine acceptors. SGMS2 directly and specifically recognizes the choline head group on the substrate. SGMS2 also requires two fatty chains on the choline-P donor molecule in order to be recognized efficiently as a substrate. SGMS2 does not function strictly as a SM synthase. SGMS2 is required for cell growth.Sphingomyelin (SM) is a major component of plasma membranes. It is preferentially concentrated in the outer leaflet and has a role in the formation of lipid rafts. SM synthases (EC 2.7.8.27), such as SGMS2, produce SM in the lumen of the Golgi and on the cell surface through the transfer of phosphocholine from phosphatidylcholine onto ceramide, yielding diacylglycerol as a side product (Huitema et al., 2004 [PubMed 14685263]) .[supplied by OMIM]. Sequence Note: removed 3 bases from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2142 BC041369.2 4-2145

UBC

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

42kDa

Ding, T., (2008) J. Lipid Res. 49 (2), 376-385

Wet Ice

365

SGMS2

SGMS2

Rabbit

Phosphatidylcholine:ceramide cholinephosphotransferase 2

NM_152621

KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY