SGRL Antilichaam - C-terminalgebied: FITC (ARP38599_T100-FITC)

Goosecoid homeobox 2

GSCL

2928

O15499

NP_005306

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the C terminal region of human GSCL

Goosecoidlike (GSCL) resides in the critical region for VCFS/DGS on 22q11. Velocardiofacial syndrome (VCFS) is phenotypically related to DiGeorge syndrome (DGS) and both syndromes are associated with hemizygous 22q11 deletions. Because many of the tissues and structures affected in VCFS/DGS derive from the pharyngeal arches of the developing embryo, it is believed that haploinsufficiency of a gene involved in embryonic development may be responsible for its etiology.Goosecoidlike (GSCL), a homeodomain-containing gene, resides in the critical region for VCFS/DGS on 22q11. Velocardiofacial syndrome (VCFS) is a developmental disorder characterized by conotruncal heart defects, craniofacial anomalies, and learning disabilities. VCFS is phenotypically related to DiGeorge syndrome (DGS) and both syndromes are associated with hemizygous 22q11 deletions. Because many of the tissues and structures affected in VCFS/DGS derive from the pharyngeal arches of the developing embryo, it is believed that haploinsufficiency of a gene involved in embryonic development may be responsible for its etiology. The gene is expressed in a limited number of adult tissues, as well as in early human development.

RNF4

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

IHC, WB

0.5 mg/ml

Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Zebrafish: 91%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

22kDa

Galili, N., (2000) Dev. Dyn. 218 (1), 102-111

Wet Ice

205

GSC2

GSC2

Rabbit

Homeobox protein goosecoid-2

NM_005315

LEALFVQNQYPDVSTRERLAGRIRLREERVEVWFKNRRAKWRHQKRASAS