SIRT4 Antilichaam - middengebied: Biotine (ARP32451_P050-Biotine)

Sirtuin 4

SIR2L4

23409

Q9Y6E7

NP_036372

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep

The immunogen is a synthetic peptide directed towards the middle region of human SIRT4

SIRT4 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT4 is included in class IV of the sirtuin family.This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family.

SKP2; Glud1; UBC; SIRT3; IDE; SLC25A6; SLC25A5

Biotin

Polyclonal Antibody

IHC, WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 79%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 93%; Rat: 93%; Sheep: 92%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

35kDa

Ahuja, N., (2007) J. Biol. Chem. 282 (46), 33583-33592

Wet Ice

314

SIRT4

SIRT4

Rabbit

NAD-dependent protein deacetylase sirtuin-4

NM_012240

QVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQV