Slamf1 Antilichaam - middengebied: FITC (ARP62712 P050-FITC)

Signaling lymphocytic activation molecule family member 1

S, IP, Slam, CD150, ESTM5, IPO-3, CDw150, ESTM51, AA177906, 4933415F16

27218

Q9QUM4

NP_038758

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep

The immunogen is a synthetic peptide directed towards the middle region of Mouse Slamf1

Slamf1 is a high-affinity self-ligand important in bidirectional T-cell to B-cell stimulation. SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another in which protein-tyrosine phosphatase 2C (PTPN11) -dependent signal transduction operates.

Sh2d1b1; Sh2d1b2; Sh2d1a

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 77%; Dog: 85%; Goat: 77%; Guinea Pig: 80%; Horse: 85%; Human: 100%; Mouse: 87%; Pig: 100%; Rabbit: 80%; Rat: 93%; Sheep: 77%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

38kDa

Wet Ice

343

SLAMF1

Slamf1

Rabbit

Signaling lymphocytic activation molecule

NM_013730

QVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSR