SLAMF1 Rabbit pAb (APR24571N)

SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes ofSLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another inwhich protein-tyrosine phosphatase 2C (PTPN11) -dependent signal transduction operates.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLAMF1 Rabbit pAb (APR24571N) .

SLAMF1; CD150; CDw150; SLAM

6504

Q13291

Cell membrane, Single-pass type I membrane protein

WB 1:500 - 1:2000

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 33kDa/37kDa/40kDa Observed MW: 37kDa/65kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6504

https://www.uniprot.org/uniprot/Q13291

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP