SLBP Antilichaam - middengebied: HRP (ARP40657_P050-HRP)

Stem-loop binding protein

HBP

7884

Q14493

NP_006518

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human SLBP

SLBP binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.This gene encodes a protein that binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.

UBC; CDK6; CDK4; UPF1; LSM10; ZNF473; USP8; ERI1

HRP: Horseradish Peroxidase

Polyclonal Antibody

IHC, WB

Affinity Purified

SLBP is supported by BioGPS gene expression data to be expressed in HepG2

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 100%; Zebrafish: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

30kDa

Borchers, C.H., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (9), 3094-3099

Wet Ice

270

SLBP

SLBP

Rabbit

Histone RNA hairpin-binding protein

NM_006527

INYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWK