SLC12A7 Rabbit pAb (APR18947N)

Mediates electroneutral potassium-chloride cotransport when activated by cell swelling. May mediate K (+ uptake into Deiters' cells in the cochlea and contribute to K (+ recycling in the inner ear. Important for the survival of cochlear outer and inner hair cells and the maintenance of the organ of Corti. May be required for basolateral Cl (- extrusion in the kidney and contribute to renal acidification (By similarity.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC12A7 Rabbit pAb (APR18947N) .

SLC12A7; KCC4

10723

Q9Y666

Cell membrane, Multi-pass membrane protein

WB 1:500 - 1:2000

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 28kDa/119kDa Observed MW: 119kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10723

https://www.uniprot.org/uniprot/Q9Y666

MPTNFTVVPVEAHADGGGDETAERTEAPGTPEGPEPERPSPGDGNPRENSPFLNNVEVEQESFFEGKNMA