SLC17A1 Rabbit pAb (APR23242N)

Important for the resorption of phosphate by the kidney. May be involved in actively transporting phosphate into cells via Na (+ cotransport in the renal brush border membrane. Plays a role in urate transport in the kidney.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC17A1 Rabbit pAb (APR23242N) .

SLC17A1; NAPI-1; NPT-1; NPT1

6568

Q14916

WB (Mouse Monocyte Macrophage Leukemia Cells)

WB 1:500 - 1:2000

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 44kDa/51kDa Observed MW: 51KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6568

https://www.uniprot.org/uniprot/Q14916

MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDIQGIILSSTSYGVIIIQVPVGY