SLC18A1 Antilichaam - middengebied: FITC (ARP35649_P050-FITC)

Solute carrier family 18 (vesicular monoamine), member 1

CGAT, VAT1, VMAT1

6570

P54219

NP_003044

Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human SLC18A1

The vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazineThe vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine (Peter et al., 1993 [PubMed 7905859]) . See also SLC18A2 (MIM 193001) .[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

IHC, WB

Affinity Purified

0.5 mg/ml

Cow: 79%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 85%; Rabbit: 91%; Rat: 86%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

56kDa

Lohoff, F.W., (er) Neuropsychobiology 57 (1-2), 55-60 (2008) In press

Wet Ice

525

SLC18A1

SLC18A1

Rabbit

Chromaffin granule amine transporter

NM_003053

YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE