SLC22A7 Antilichaam - C-terminal regio : HRP (ARP42708 P050-HRP)

Solute carrier family 22 (organic anion transporter), member 7

NLT, OAT2, hOAT11

10864

Q9Y694

NP_696961

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the C terminal region of human SLC22A7

SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.

HRP: Horseradish Peroxidase

Polyclonal Antibody

IHC, WB

Affinity Purified

There is BioGPS gene expression data showing that SLC22A7 is expressed in Jurkat

0.5 mg/ml

Cow: 93%; Dog: 91%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

26kDa

Kimura, K., (2006) Genome Res. 16 (1), 55-65

Wet Ice

235

SLC22A7

SLC22A7

Rabbit

Solute carrier family 22 member 7

NM_153320

LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE