SLC22A8 Antilichaam - middengebied: FITC (ARP41548_P050-FITC)

Solute carrier family 22 (organic anion transporter), member 8

OAT3

9376

Q8TCC7

NP_004245

Human, Mouse, Cow, Dog, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human SLC22A8

SLC22A8 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A8 is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 79%; Dog: 79%; Human: 100%; Mouse: 86%; Rabbit: 86%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

60kDa

Windass, A.S., (2007) J. Pharmacol. Exp. Ther. 322 (3), 1221-1227

Wet Ice

542

SLC22A8

SLC22A8

Rabbit

Solute carrier family 22 member 8

NM_004254

PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS