SLC25A16 Antilichaam - middengebied: Biotine (ARP441126_P050-Biotine)

Solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16

GDA, GDC, ML7, hML7, HGT.1, D10S105E

8034

P16260

NP_689920

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human SLC25A16

SLC25A16 is a protein that contains three tandemly repeated mitochondrial carrier protein domains. The protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. SLC25A16 gene has a possible role in Graves' disease.This gene encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has a possible role in Graves' disease.

UBC

Biotin

Polyclonal Antibody

WB

Affinity Purified

There is BioGPS gene expression data showing that SLC25A16 is expressed in 721_B

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

36kDa

Prohl, C., (2001) Mol. Cell. Biol. 21 (4), 1089-1097

Wet Ice

332

SLC25A16

SLC25A16

Rabbit

Graves disease carrier protein

NM_152707

LSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRR